Ver mas grande
NPPA (Human) Recombinant Protein
AB-P8980
Producto nuevo
NPPA (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | NPPA |
| Gene Alias | ANF|ANP|ATFB6|CDD-ANF|PND |
| Gene Description | natriuretic peptide precursor A |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM Tris buffer, 50 mM NaCl and 5% w/v trehalosa, pH 7.5. |
| Gene ID | 4878 |
Más información
Human NPPA (P01160, 26 a.a. - 123 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.