View larger
Human NPPA (P01160, 26 a.a. - 123 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in <i>Escherichi
AB-P8980
New product
NPPA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | NPPA |
| Gene Alias | ANF|ANP|ATFB6|CDD-ANF|PND |
| Gene Description | natriuretic peptide precursor A |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 20 mM Tris buffer, 50 mM NaCl and 5% w/v trehalosa, pH 7.5. |
| Gene ID | 4878 |
More info
Human NPPA (P01160, 26 a.a. - 123 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.