NOV (Human) Recombinant Protein Ver mas grande

NOV (Human) Recombinant Protein

AB-P8977

Producto nuevo

NOV (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNC
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM Tris-HCl, pH 8.6 and 150 mM NaCl.
Gene ID 4856

Más información

Human NOV (P48745) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

NOV (Human) Recombinant Protein

NOV (Human) Recombinant Protein