NOV (Human) Recombinant Protein
  • NOV (Human) Recombinant Protein

NOV (Human) Recombinant Protein

Ref: AB-P8977
NOV (Human) Recombinant Protein

Información del producto

Human NOV (P48745) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNC
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM Tris-HCl, pH 8.6 and 150 mM NaCl.
Gene ID 4856

Enviar un mensaje


NOV (Human) Recombinant Protein

NOV (Human) Recombinant Protein