NOV (Human) Recombinant Protein View larger

Human NOV (P48745) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8977

New product

NOV (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name NOV
Gene Alias CCN3|IGFBP9
Gene Description nephroblastoma overexpressed gene
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNC
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 20mM Tris-HCl, pH 8.6 and 150 mM NaCl.
Gene ID 4856

More info

Human NOV (P48745) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human NOV (P48745) recombinant protein expressed in <i>Escherichia coli</i>.

Human NOV (P48745) recombinant protein expressed in <i>Escherichia coli</i>.