NOG (Human) Recombinant Protein Ver mas grande

NOG (Human) Recombinant Protein

AB-P8975

Producto nuevo

NOG (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH7.4 and 0.02 % Tween-20 and 5% trehalose.
Gene ID 9241

Más información

Human NOG (Q13253) recombinant protein expressed in Baculovirus.

Consulta sobre un producto

NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein