NOG (Human) Recombinant Protein
  • NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein

Ref: AB-P8975
NOG (Human) Recombinant Protein

Información del producto

Human NOG (Q13253) recombinant protein expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name NOG
Gene Alias SYM1|SYNS1
Gene Description noggin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH7.4 and 0.02 % Tween-20 and 5% trehalose.
Gene ID 9241

Enviar uma mensagem


NOG (Human) Recombinant Protein

NOG (Human) Recombinant Protein