Ver mas grande
GMFB (Human) Recombinant Protein
AB-P8751
Producto nuevo
GMFB (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | GMFB |
| Gene Alias | GMF |
| Gene Description | glia maturation factor, beta |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC for longer periods of time. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 M NaCl, 1 mM DTT. |
| Gene ID | 2764 |
Más información
Human GMFB full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.