GMFB (Human) Recombinant Protein
  • GMFB (Human) Recombinant Protein

GMFB (Human) Recombinant Protein

Ref: AB-P8751
GMFB (Human) Recombinant Protein

Información del producto

Human GMFB full-length recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name GMFB
Gene Alias GMF
Gene Description glia maturation factor, beta
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C for longer periods of time.
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Form Liquid
Antigen species Target species Human
Storage Buffer Solution (1 mg/mL) containing 20 mM Tris-HCl, pH 8.0, 10% glycerol, 0.1 M NaCl, 1 mM DTT.
Gene ID 2764

Enviar uma mensagem


GMFB (Human) Recombinant Protein

GMFB (Human) Recombinant Protein