Ver mas grande
GMFB (Human) Recombinant Protein
AB-P8750
Producto nuevo
GMFB (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | GMFB |
| Gene Alias | GMF |
| Gene Description | glia maturation factor, beta |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNDKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized after dialysis against from solution containing 20 mM PBS, pH 7.4, 130 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 2764 |
Más información
Human GMFB recombinant protein expressed in Escherichia coli.