GMFB (Human) Recombinant Protein
  • GMFB (Human) Recombinant Protein

GMFB (Human) Recombinant Protein

Ref: AB-P8750
GMFB (Human) Recombinant Protein

Información del producto

Human GMFB recombinant protein expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name GMFB
Gene Alias GMF
Gene Description glia maturation factor, beta
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPELKELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNDKLVQTAELTKVFEIRNTEDLTEEWLREKLGFFH
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized after dialysis against from solution containing 20 mM PBS, pH 7.4, 130 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 2764

Enviar uma mensagem


GMFB (Human) Recombinant Protein

GMFB (Human) Recombinant Protein