Ver mas grande
GH1 (Bovine) Recombinant Protein
AB-P8720
Producto nuevo
GH1 (Bovine) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GH |
| Gene Alias | - |
| Gene Description | growth hormone |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETMPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRRGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF |
| Form | Lyophilized |
| Antigen species Target species | Bovine |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 4.5 mM NaHCO<sub>3</sub>, pH 8-9. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 280804 |
Más información
Bovine GH1 recombinant protein expressed in?Escherichia coli.