GH1 (Bovine) Recombinant Protein View larger

Bovine GH1 recombinant protein expressed in?<i>Escherichia coli</i>.

AB-P8720

New product

GH1 (Bovine) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 100 ug
Gene Name GH
Gene Alias -
Gene Description growth hormone
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe
Immunogen Prot. Seq AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETMPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRRGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Form Lyophilized
Antigen species Target species Bovine
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 4.5 mM NaHCO<sub>3</sub>, pH 8-9. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 280804

More info

Bovine GH1 recombinant protein expressed in?Escherichia coli.

Enviar uma mensagem

Bovine GH1 recombinant protein expressed in?<i>Escherichia coli</i>.

Bovine GH1 recombinant protein expressed in?<i>Escherichia coli</i>.