GH1 (Bovine) Recombinant Protein
  • GH1 (Bovine) Recombinant Protein

GH1 (Bovine) Recombinant Protein

Ref: AB-P8720
GH1 (Bovine) Recombinant Protein

Información del producto

Bovine GH1 recombinant protein expressed in?Escherichia coli.
Información adicional
Size 100 ug
Gene Name GH
Gene Alias -
Gene Description growth hormone
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETMPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRRGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Form Lyophilized
Antigen species Target species Bovine
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 4.5 mM NaHCO3, pH 8-9. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 280804

Enviar uma mensagem


GH1 (Bovine) Recombinant Protein

GH1 (Bovine) Recombinant Protein