GH1 (Human) Recombinant Protein
  • GH1 (Human) Recombinant Protein

GH1 (Human) Recombinant Protein

Ref: AB-P8715
GH1 (Human) Recombinant Protein

Información del producto

Human GH1 recombinant protein with His tag in N-terminus expressed in Nicotiana benthamiana plant.
Información adicional
Size 2 x 10 ug
Gene Name GH1
Gene Alias GH|GH-N|GHN|hGH-N
Gene Description growth hormone 1
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (1 mg/mL) was lyophilized from a solution containing 0.05M PBS, pH7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 2688

Enviar un mensaje


GH1 (Human) Recombinant Protein

GH1 (Human) Recombinant Protein