View larger
Human GH1 recombinant protein with His tag in N-terminus expressed in Nicotiana benthamiana plant.
AB-P8715
New product
GH1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | GH1 |
| Gene Alias | GH|GH-N|GHN|hGH-N |
| Gene Description | growth hormone 1 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (1 mg/mL) was lyophilized from a solution containing 0.05M PBS, pH7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 2688 |
More info
Human GH1 recombinant protein with His tag in N-terminus expressed in Nicotiana benthamiana plant.