Ver mas grande
GDF15 (Human) Recombinant Protein
AB-P8699
Producto nuevo
GDF15 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | GDF15 |
| Gene Alias | GDF-15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB |
| Gene Description | growth differentiation factor 15 |
| Storage Conditions | Store at 4ºC for 2-4 weeks and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | Solution containing 10mM Sodium citrate, pH 3.5, 10% glycerol. |
| Gene ID | 9518 |
Más información
Human GDF15 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.