GDF15 (Human) Recombinant Protein
  • GDF15 (Human) Recombinant Protein

GDF15 (Human) Recombinant Protein

Ref: AB-P8699
GDF15 (Human) Recombinant Protein

Información del producto

Human GDF15 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name GDF15
Gene Alias GDF-15|MIC-1|MIC1|NAG-1|PDF|PLAB|PTGFB
Gene Description growth differentiation factor 15
Storage Conditions Store at 4C for 2-4 weeks and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Form Liquid
Antigen species Target species Human
Storage Buffer Solution containing 10mM Sodium citrate, pH 3.5, 10% glycerol.
Gene ID 9518

Enviar uma mensagem


GDF15 (Human) Recombinant Protein

GDF15 (Human) Recombinant Protein