Ver mas grande
GDF11 (Human) Recombinant Protein
AB-P8697
Producto nuevo
GDF11 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | GDF11 |
| Gene Alias | BMP-11|BMP11 |
| Gene Description | growth differentiation factor 11 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein(1 mg/mL) was lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 10220 |
Más información
Human GDF11 recombinant protein expressed in Escherichia coli.