GDF11 (Human) Recombinant Protein
  • GDF11 (Human) Recombinant Protein

GDF11 (Human) Recombinant Protein

Ref: AB-P8697
GDF11 (Human) Recombinant Protein

Información del producto

Human GDF11 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name GDF11
Gene Alias BMP-11|BMP11
Gene Description growth differentiation factor 11
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key Func
Immunogen Prot. Seq NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein(1 mg/mL) was lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 10220

Enviar uma mensagem


GDF11 (Human) Recombinant Protein

GDF11 (Human) Recombinant Protein