GDF3 (Human) Recombinant Protein
  • GDF3 (Human) Recombinant Protein

GDF3 (Human) Recombinant Protein

Ref: AB-P8689
GDF3 (Human) Recombinant Protein

Información del producto

Human GDF3 recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name GDF3
Gene Alias -
Gene Description growth differentiation factor 3
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG
Form Lyophilized
Antigen species Target species Human
Storage Buffer Protein (0.5 mg/mL) was lyophilized from a solution containing 30 mM Acetate buffer, pH 4.0. Reconstitute the lyophilized powder in 100mM Acetate buffer, pH 4.0 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. Fo
Gene ID 9573

Enviar un mensaje


GDF3 (Human) Recombinant Protein

GDF3 (Human) Recombinant Protein