View larger
Human GDF3 recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P8689
New product
GDF3 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | GDF3 |
| Gene Alias | - |
| Gene Description | growth differentiation factor 3 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MKHHHHHHASAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFSLTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDECGCG |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Protein (0.5 mg/mL) was lyophilized from a solution containing 30 mM Acetate buffer, pH 4.0. Reconstitute the lyophilized powder in 100mM Acetate buffer, pH 4.0 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. Fo |
| Gene ID | 9573 |
More info
Human GDF3 recombinant protein with His tag in N-terminus expressed in Escherichia coli.