FLT3LG (Monkey) Recombinant Protein Ver mas grande

FLT3LG (Monkey) Recombinant Protein

AB-P8647

Producto nuevo

FLT3LG (Monkey) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 x 10 ug
Gene Name LOC719239
Gene Alias -
Gene Description similar to SL cytokine precursor (Fms-related tyrosine kinase 3 ligand) (Flt3 ligand) (Flt3L)
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRP
Form Lyophilized
Storage Buffer Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 719239

Más información

Monkey FLT3LG recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

FLT3LG (Monkey) Recombinant Protein

FLT3LG (Monkey) Recombinant Protein