Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
FLT3LG (Monkey) Recombinant Protein
Abnova
FLT3LG (Monkey) Recombinant Protein
Ref: AB-P8647
FLT3LG (Monkey) Recombinant Protein
Contacte-nos
Información del producto
Monkey FLT3LG recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
2 x 10 ug
Gene Name
LOC719239
Gene Alias
-
Gene Description
similar to SL cytokine precursor (Fms-related tyrosine kinase 3 ligand) (Flt3 ligand) (Flt3L)
Storage Conditions
Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C.
Avoid repeated freeze/thaw cycles.
Application Key
Func
Immunogen Prot. Seq
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVPSNLQDEELCGALWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQHPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPRSPGALEATALTAPQRP
Form
Lyophilized
Storage Buffer
Lyophilized from a solution containing 1X PBS, pH7.4. Reconstitute the lyophilized powder in ddH
2
O to 100 ug/mL.
Gene ID
719239
Enviar uma mensagem
FLT3LG (Monkey) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*