Ver mas grande
Fgf21 (Mouse) Recombinant Protein
AB-P8631
Producto nuevo
Fgf21 (Mouse) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | Fgf21 |
| Gene Alias | - |
| Gene Description | fibroblast growth factor 21 |
| Storage Conditions | Lyophilized protein at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repe |
| Immunogen Prot. Seq | MKHHHHHHASAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Protein(0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 0.5 mg/mL, and is not sterile! Please filter the product by an sterile filter before use. |
| Gene ID | 56636 |
Más información
Mouse Fgf21 recombinant protein with His tag in N-terminus expressed in Escherichia coli.