Fgf21 (Mouse) Recombinant Protein
  • Fgf21 (Mouse) Recombinant Protein

Fgf21 (Mouse) Recombinant Protein

Ref: AB-P8631
Fgf21 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf21 recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Información adicional
Size 2 x 10 ug
Gene Name Fgf21
Gene Alias -
Gene Description fibroblast growth factor 21
Storage Conditions Lyophilized protein at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated
Application Key SDS-PAGE
Immunogen Prot. Seq MKHHHHHHASAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Protein(0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5 mg/mL, and is not sterile! Please filter the product by an sterile filter before use.
Gene ID 56636

Enviar uma mensagem


Fgf21 (Mouse) Recombinant Protein

Fgf21 (Mouse) Recombinant Protein