Fgf1 (Rat) Recombinant Protein
  • Fgf1 (Rat) Recombinant Protein

Fgf1 (Rat) Recombinant Protein

Ref: AB-P8590
Fgf1 (Rat) Recombinant Protein

Información del producto

Rat Fgf1 recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Fgf1
Gene Alias HBGF-1|HBGF1
Gene Description fibroblast growth factor 1
Storage Conditions Stored at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C for long term storage.
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Form Lyophilized
Antigen species Target species Rat
Storage Buffer Lyophilized from 5 mM Na2PO4, 50 mM NaCl solution, pH7.5,. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 25317

Enviar un mensaje


Fgf1 (Rat) Recombinant Protein

Fgf1 (Rat) Recombinant Protein