View larger
Rat Fgf1 recombinant protein expressed in <i>Escherichia coli</i>.
AB-P8590
New product
Fgf1 (Rat) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | Fgf1 |
| Gene Alias | HBGF-1|HBGF1 |
| Gene Description | fibroblast growth factor 1 |
| Storage Conditions | Stored at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Storage Buffer | Lyophilized from 5 mM Na<sub>2</sub>PO<sub>4</sub>, 50 mM NaCl solution, pH7.5,. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 25317 |
More info
Rat Fgf1 recombinant protein expressed in Escherichia coli.