Ver mas grande
Fgf1 (Mouse) Recombinant Protein
AB-P8589
Producto nuevo
Fgf1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Fgf1 |
| Gene Alias | Dffrx|Fam|Fgf-1|Fgfa |
| Gene Description | fibroblast growth factor 1 |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (30% glycerol, 1 mM DTT, 0.1M NaCl). |
| Gene ID | 14164 |
Más información
Mouse Fgf1 recombinant protein with His tag in N-terminus expressed in Escherichia coli.