View larger
Mouse Fgf1 recombinant protein with His tag in N-terminus expressed in <i>Escherichia coli</i>.
AB-P8589
New product
Fgf1 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | Fgf1 |
| Gene Alias | Dffrx|Fam|Fgf-1|Fgfa |
| Gene Description | fibroblast growth factor 1 |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (30% glycerol, 1 mM DTT, 0.1M NaCl). |
| Gene ID | 14164 |
More info
Mouse Fgf1 recombinant protein with His tag in N-terminus expressed in Escherichia coli.