Fgf1 (Mouse) Recombinant Protein
  • Fgf1 (Mouse) Recombinant Protein

Fgf1 (Mouse) Recombinant Protein

Ref: AB-P8589
20 ug

Información del producto

Fgf1 (Mouse) Recombinant Protein
Información adicional
Size 20 ug
Gene Name Fgf1
Gene Alias Dffrx|Fam|Fgf-1|Fgfa
Gene Description fibroblast growth factor 1
Storage Conditions Stored at 4C for 2-4 weeks, should be stored at -20C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Form Liquid
Antigen species Target species Mouse
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (30% glycerol, 1 mM DTT, 0.1M NaCl).
Gene ID 14164

Enviar uma mensagem


Fgf1 (Mouse) Recombinant Protein

Fgf1 (Mouse) Recombinant Protein