Fgf1 (Mouse) Recombinant Protein
  • Fgf1 (Mouse) Recombinant Protein

Fgf1 (Mouse) Recombinant Protein

Ref: AB-P8588
Fgf1 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf1 recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Fgf1
Gene Alias Dffrx|Fam|Fgf-1|Fgfa
Gene Description fibroblast growth factor 1
Storage Conditions Stored at room temperature for 3 weeks, should be stored at -20C. Protein aliquots at 4C for 2-7 days and should be stored at -20C to -80C for long term storage.
Avoid repeated freeze/thaw cycles.
Application Key Func
Immunogen Prot. Seq MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Gene ID 14164

Enviar un mensaje


Fgf1 (Mouse) Recombinant Protein

Fgf1 (Mouse) Recombinant Protein