Ver mas grande
Fgf1 (Mouse) Recombinant Protein
AB-P8588
Producto nuevo
Fgf1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Fgf1 |
| Gene Alias | Dffrx|Fam|Fgf-1|Fgfa |
| Gene Description | fibroblast growth factor 1 |
| Storage Conditions | Stored at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | Lyophilized from a solution containing 1X PBS, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL. |
| Gene ID | 14164 |
Más información
Mouse Fgf1 recombinant protein expressed in Escherichia coli.