Fgf1 (Mouse) Recombinant Protein View larger

Mouse Fgf1 recombinant protein expressed in <i>Escherichia coli</i>.

AB-P8588

New product

Fgf1 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 50 ug
Gene Name Fgf1
Gene Alias Dffrx|Fam|Fgf-1|Fgfa
Gene Description fibroblast growth factor 1
Storage Conditions Stored at room temperature for 3 weeks, should be stored at -20ºC. Protein aliquots at 4ºC for 2-7 days and should be stored at -20ºC to -80ºC for long term storage. <br>Avoid repeated freeze/thaw cycles.
Immunogen Prot. Seq MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from a solution containing 1X PBS, pH 7.5. Reconstitute the lyophilized powder in ddH<sub>2</sub>O to 100 ug/mL.
Gene ID 14164

More info

Mouse Fgf1 recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Fgf1 recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Fgf1 recombinant protein expressed in <i>Escherichia coli</i>.