Ver mas grande
FASLG (Human) Recombinant Protein
AB-P8583
Producto nuevo
FASLG (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | FASLG |
| Gene Alias | APT1LG1|CD178|CD95L|FASL|TNFSF6 |
| Gene Description | Fas ligand (TNF superfamily, member 6) |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 20mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.4 M urea). |
| Gene ID | 356 |
Más información
Human FASLG partial recombinant protein expressed in Escherichia coli.