FASLG (Human) Recombinant Protein
  • FASLG (Human) Recombinant Protein

FASLG (Human) Recombinant Protein

Ref: AB-P8583
FASLG (Human) Recombinant Protein

Información del producto

Human FASLG partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name FASLG
Gene Alias APT1LG1|CD178|CD95L|FASL|TNFSF6
Gene Description Fas ligand (TNF superfamily, member 6)
Storage Conditions Stored at 4C for 2-4 weeks, should be stored at -20C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid repeated freeze/thaw cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Form Liquid
Antigen species Target species Human
Storage Buffer In  20mM Tris-HCl buffer, pH 8.0 (10% glycerol, 0.4 M urea).
Gene ID 356

Enviar uma mensagem


FASLG (Human) Recombinant Protein

FASLG (Human) Recombinant Protein