Ver mas grande
EPOR (Human) Recombinant Protein
AB-P8578
Producto nuevo
EPOR (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 2 x 10 ug |
| Gene Name | EPOR |
| Gene Alias | MGC138358 |
| Gene Description | erythropoietin receptor |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
| Gene ID | 2057 |
Más información
Human EPOR partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.