View larger
Human EPOR partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.
AB-P8578
New product
EPOR (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | EPOR |
| Gene Alias | MGC138358 |
| Gene Description | erythropoietin receptor |
| Storage Conditions | Stored at 4ºC for 2-4 weeks, should be stored at -20ºC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). <br>Avoid repeated freeze/thaw cycles. |
| Immunogen Prot. Seq | APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
| Gene ID | 2057 |
More info
Human EPOR partial recombinant protein with His tag in C-terminus expressed in Baculovirus cells.