EREG (Human) Recombinant Protein
  • EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein

Ref: AB-P8568
EREG (Human) Recombinant Protein

Información del producto

Human EREG (O14944) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name EREG
Gene Alias ER
Gene Description epiregulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Epiregulin was lyophilized from 0.5mg/ml solution ciontaing 20mM PBS buffer pH-7.4 containing 20mM sodium chloride.
Gene ID 2069

Enviar un mensaje


EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein