EREG (Human) Recombinant Protein
  • EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein

Ref: AB-P8568
25 ug

Información del producto

EREG (Human) Recombinant Protein
Información adicional
Size 25 ug
Gene Name EREG
Gene Alias ER
Gene Description epiregulin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Epiregulin was lyophilized from 0.5mg/ml solution ciontaing 20mM PBS buffer pH-7.4 containing 20mM sodium chloride.
Gene ID 2069

Enviar uma mensagem


EREG (Human) Recombinant Protein

EREG (Human) Recombinant Protein