EPGN (Human) Recombinant Protein
  • EPGN (Human) Recombinant Protein

EPGN (Human) Recombinant Protein

Ref: AB-P8567
2 x 10 ug

Información del producto

EPGN (Human) Recombinant Protein
Información adicional
Size 2 x 10 ug
Gene Name EPGN
Gene Alias ALGV3072|EPG|FLJ75542|PRO9904|epigen
Gene Description epithelial mitogen homolog (mouse)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq ADPAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKHHHHHH.
Form Liquid
Antigen species Target species Human
Storage Buffer EPGN protein solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol
Gene ID 255324

Enviar un mensaje


EPGN (Human) Recombinant Protein

EPGN (Human) Recombinant Protein