View larger
Human EPGN (Q6UW88, 23a.a. - 110 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus
AB-P8567
New product
EPGN (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 2 x 10 ug |
| Gene Name | EPGN |
| Gene Alias | ALGV3072|EPG|FLJ75542|PRO9904|epigen |
| Gene Description | epithelial mitogen homolog (mouse) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | ADPAAVTVTPPITAQQGNWTVNKTEADNIEGPIALKFSHLCLEDHNSYCINGACAFHHELEKAICRCFTGYTGERCEHLTLTSYAVDSYEKHHHHHH. |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | EPGN protein solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol |
| Gene ID | 255324 |
More info
Human EPGN (Q6UW88, 23a.a. - 110 a.a.) partial-length recombinant protein with His-tag at C-terminal expressed in Baculovirus.