Eng (Mouse) Recombinant Protein
  • Eng (Mouse) Recombinant Protein

Eng (Mouse) Recombinant Protein

Ref: AB-P8563
Eng (Mouse) Recombinant Protein

Información del producto

Mouse Eng (Q63961) recombinant protein with His-tag at C-terminal expressed in Baculovirus.
Información adicional
Size 2 x 10 ug
Gene Name Eng
Gene Alias AI528660|AI662476|CD105|S-endoglin
Gene Description endoglin
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHG
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer solution with no additives.
Gene ID 13805

Enviar un mensaje


Eng (Mouse) Recombinant Protein

Eng (Mouse) Recombinant Protein