Eng (Mouse) Recombinant Protein View larger

Mouse Eng (Q63961) recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus</i>.

AB-P8563

New product

Eng (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.


Data sheet

Size 2 x 10 ug
Gene Name Eng
Gene Alias AI528660|AI662476|CD105|S-endoglin
Gene Description endoglin
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHG
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer solution with no additives.
Gene ID 13805

More info

Mouse Eng (Q63961) recombinant protein with His-tag at C-terminal expressed in Baculovirus.

Enviar uma mensagem

Mouse Eng (Q63961) recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus</i>.

Mouse Eng (Q63961) recombinant protein with His-tag at C-terminal expressed in <i>Baculovirus</i>.