EGF (Human) Recombinant Protein
  • EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein

Ref: AB-P8548
EGF (Human) Recombinant Protein

Información del producto

Human EGF (P01133, 1 a.a. - 51 a.a.) partial-length recombinant protein expressed in Saccharomyces cerevisiae.
Información adicional
Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 1950

Enviar un mensaje


EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein