EGF (Human) Recombinant Protein Ver mas grande

EGF (Human) Recombinant Protein

AB-P8548

Producto nuevo

EGF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.


Hoja técnica

Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 1950

Más información

Human EGF (P01133, 1 a.a. - 51 a.a.) partial-length recombinant protein expressed in Saccharomyces cerevisiae.

Consulta sobre un producto

EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein