View larger
Human EGF (P01133, 1 a.a. - 51 a.a.) partial-length recombinant protein expressed in <i>Saccharomyces cerevisiae</i>.
AB-P8548
New product
EGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | EGF |
| Gene Alias | HOMG4|URG |
| Gene Description | epidermal growth factor (beta-urogastrone) |
| Storage Conditions | Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. |
| Immunogen Prot. Seq | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE. |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS, pH 7.4. |
| Gene ID | 1950 |
More info
Human EGF (P01133, 1 a.a. - 51 a.a.) partial-length recombinant protein expressed in Saccharomyces cerevisiae.