EGF (Human) Recombinant Protein Ver mas grande

EGF (Human) Recombinant Protein

AB-P8545

Producto nuevo

EGF (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.


Hoja técnica

Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 1950

Más información

Human EGF (Q6QBS2) recombinant protein expressed in Pichia Pastoris.

Consulta sobre un producto

EGF (Human) Recombinant Protein

EGF (Human) Recombinant Protein