EGF (Human) Recombinant Protein View larger

Human EGF (Q6QBS2) recombinant protein expressed in <i>Pichia Pastoris</i>.

AB-P8545

New product

EGF (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 1 ponto de fidelização. Seu carrinho totalizará 1 ponto de fidelização que podem ser convertidos num vale de desconto de 4.00EUR.


Data sheet

Size 100 ug
Gene Name EGF
Gene Alias HOMG4|URG
Gene Description epidermal growth factor (beta-urogastrone)
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.4.
Gene ID 1950

More info

Human EGF (Q6QBS2) recombinant protein expressed in Pichia Pastoris.

Enviar uma mensagem

Human EGF (Q6QBS2) recombinant protein expressed in <i>Pichia Pastoris</i>.

Human EGF (Q6QBS2) recombinant protein expressed in <i>Pichia Pastoris</i>.