Prok1 (Mouse) Recombinant Protein Ver mas grande

Prok1 (Mouse) Recombinant Protein

AB-P8543

Producto nuevo

Prok1 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name Prok1
Gene Alias EG-VEGF
Gene Description prokineticin 1
Storage Conditions Store at -20ºC. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Immunogen Prot. Seq AVITGACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFLRKRQHHTCPCSPSLLCSRFPDGRYRCFRDLKNANF.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS pH7.4 and 3% Trehalose.
Gene ID 246691

Más información

Mouse Prok1 (Q14A28) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Prok1 (Mouse) Recombinant Protein

Prok1 (Mouse) Recombinant Protein