Prok1 (Mouse) Recombinant Protein
  • Prok1 (Mouse) Recombinant Protein

Prok1 (Mouse) Recombinant Protein

Ref: AB-P8543
Prok1 (Mouse) Recombinant Protein

Información del producto

Mouse Prok1 (Q14A28) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Prok1
Gene Alias EG-VEGF
Gene Description prokineticin 1
Storage Conditions Store at -20C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles.
Application Key SDS-PAGE
Immunogen Prot. Seq AVITGACERDIQCGAGTCCAISLWLRGLRLCTPLGREGEECHPGSHKIPFLRKRQHHTCPCSPSLLCSRFPDGRYRCFRDLKNANF.
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized from PBS pH7.4 and 3% Trehalose.
Gene ID 246691

Enviar uma mensagem


Prok1 (Mouse) Recombinant Protein

Prok1 (Mouse) Recombinant Protein