PROK1 (Human) Recombinant Protein Ver mas grande

PROK1 (Human) Recombinant Protein

AB-P8542

Producto nuevo

PROK1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 20 ug
Gene Name PROK1
Gene Alias EGVEGF|PK1|PRK1
Gene Description prokineticin 1
Storage Conditions Lyophilized EG-VEGF Human Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18ºC. Upon reconstitution EG-VEGF should be stored at 4ºC between 2-7 days and for future use below -18ºC.
Immunogen Prot. Seq AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.1% Trifluoroacetic Acid (TFA).
Gene ID 84432

Más información

Human PROK1 (P58294) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

PROK1 (Human) Recombinant Protein

PROK1 (Human) Recombinant Protein