PROK1 (Human) Recombinant Protein
  • PROK1 (Human) Recombinant Protein

PROK1 (Human) Recombinant Protein

Ref: AB-P8542
20 ug

Información del producto

PROK1 (Human) Recombinant Protein
Información adicional
Size 20 ug
Gene Name PROK1
Gene Alias EGVEGF|PK1|PRK1
Gene Description prokineticin 1
Storage Conditions Lyophilized EG-VEGF Human Recombinant although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution EG-VEGF should be stored at 4C between 2-7 days and for future use below -18C.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF.
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.1% Trifluoroacetic Acid (TFA).
Gene ID 84432

Enviar uma mensagem


PROK1 (Human) Recombinant Protein

PROK1 (Human) Recombinant Protein