Ver mas grande
Ctla4 (Mouse) Recombinant Protein
AB-P8533
Producto nuevo
Ctla4 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | Ctla4 |
| Gene Alias | Cd152|Ctla-4|Ly-56 |
| Gene Description | cytotoxic T-lymphocyte-associated protein 4 |
| Storage Conditions | Store at 4ºC if entire vial will be used within 2-4 weeks. Store, frozen at -20ºC for longer periods of time. |
| Immunogen Prot. Seq | IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Storage Buffer | CTLA4 protein solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol. |
| Gene ID | 12477 |
Más información
Mouse Ctla4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in Baculovirus.