Ctla4 (Mouse) Recombinant Protein View larger

Mouse Ctla4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in <i>Bacul

AB-P8533

New product

Ctla4 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.


Data sheet

Size 20 ug
Gene Name Ctla4
Gene Alias Cd152|Ctla-4|Ly-56
Gene Description cytotoxic T-lymphocyte-associated protein 4
Storage Conditions Store at 4ºC if entire vial will be used within 2-4 weeks. Store, frozen at -20ºC for longer periods of time.
Immunogen Prot. Seq IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE
Form Liquid
Antigen species Target species Mouse
Storage Buffer CTLA4 protein solution (0.5mg/ml) contains Phosphate Buffered Saline (pH 7.4) and 10% glycerol.
Gene ID 12477

More info

Mouse Ctla4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in Baculovirus.

Enviar uma mensagem

Mouse Ctla4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in <i>Bacul

Mouse Ctla4 (P16410, 36 a.a. - 161 a.a) partial-length recombinant protein with hIgG-His-tag at C-terminal expressed in <i>Bacul